Q9V0T9 G8ZJG4 GATD_PYRAB Glutamyl-tRNA(Gln) amidotransferase subunit D Glu-ADT subunit D 6.3.5.- gatD PYRAB07000 PAB1901 Pyrococcus abyssi (strain GE5 / Orsay) Archaea Methanobacteriati Methanobacteriota Thermococci Thermococcales Thermococcaceae Pyrococcus NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] GE5 / Orsay GENOME REANNOTATION GE5 / Orsay Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). The GatDE system is specific for glutamate and does not act on aspartate. L-glutamyl-tRNA(Gln) + L-glutamine + ATP + H2O = L-glutaminyl-tRNA(Gln) + L-glutamate + ADP + phosphate + H(+) Heterodimer of GatD and GatE. Q9V0T9 Q9V0U0 gatE false 3 Belongs to the asparaginase 1 family. GatD subfamily. 3D-structure ATP-binding Ligase Nucleotide-binding Protein biosynthesis Reference proteome MRVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIMPPYELSAGDTLVLKLENGYNIGIALEKIRRIEVLERAKVKPEVHFEALIEGKPGLPEVTIIGTGGTIASRIDYETGAVYPAFTAEELAKAVPEIFEVANVKPKLLFNIFSEDMKPKHWVKIAHEVAKALNSGDYGVVVAHGTDTMGYTAAALSFMLRNLGKPVVLVGAQRSSDRPSSDAAMNLICSVRMATSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKIWPNGEIEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIERAVEEGVAVCMTSQCIYGRVNLNVYSTGRKLLKAGVIPCEDMLPETAYVKLMWVLGHTQNLEEVRKMMLTNYAGEITPYTRFDTYLR Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License