Q9CQT9 RCAF1_MOUSE GEL complex subunit OPTI Obligate partner of TMCO1 insertase Rab5-interacting protein RIP5 Respirasome Complex Assembly Factor 1 RCAF1 Rab5if Rcaf1 Mus musculus Mouse Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] C57BL/6J Embryo Kidney NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Liver FUNCTION INTERACTION WITH NDUFS3; COXFA4; NDUFV1; NDUFA9; NDUFS8; UQCRC2; COX5A AND COX7C SUBCELLULAR LOCATION TISSUE SPECIFICITY Component of the multi-pass translocon (MPT) complex that mediates insertion of multi-pass membrane proteins into the lipid bilayer of membranes (By similarity). The MPT complex takes over after the SEC61 complex: following membrane insertion of the first few transmembrane segments of proteins by the SEC61 complex, the MPT complex occludes the lateral gate of the SEC61 complex to promote insertion of subsequent transmembrane regions (By similarity). Within the MPT complex, the GEL subcomplex may mediate insertion of transmembrane regions into the membrane (By similarity). In addition to its role in multi-pass membrane insertion, RAB5IF/OPTI also acts as an assembly factor for mitochondrial respiratory complexes (PubMed:31536960). Component of the GET- and EMC-like (GEL) complex, composed of RAB5IF/OPTI and TMCO1 (By similarity). The GEL complex is part of the multi-pass translocon (MPT) complex, composed of three subcomplexes, the GEL complex (composed of RAB5IF/OPTI and TMCO1), the BOS complex (composed of NCLN/Nicalin, NOMO1 and TMEM147) and the PAT complex (composed of WDR83OS/Asterix and CCDC47) (By similarity). The MPT complex associates with the SEC61 complex (By similarity). Interacts with NDUFS3, COXFA4, NDUFV1, NDUFA9 and NDUFS8 of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) (PubMed:31536960). Interacts with UQCRC2 of the ubiquinol-cytochrome c reductase complex (Complex III) (PubMed:31536960). Interacts with COX5A and COX7C of the cytochrome c oxidase complex (Complex IV) (PubMed:31536960). Endoplasmic reticulum membrane Multi-pass membrane protein Mitochondrion inner membrane Multi-pass membrane protein Expressed in neuronal cells. Belongs to the EMC6 family. Endoplasmic reticulum Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Transmembrane Transmembrane helix MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWDDKDEFLDVIYWFRQIIALVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIHYD Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License