Q8T9V5 Q8T9V5_AEDAE 1,4-beta-N-acetylmuramidase C 3.2.1.17 lysozyme C Aedes aegypti Yellowfever mosquito Culex aegypti Eukaryota Metazoa Ecdysozoa Arthropoda Altocrustacea Allotriocarida Hexapoda Insecta Pterygota Neoptera Eumetabola Endopterygota Aparaglossata Panorpida Diptera Nematocera Culicoidea Culicidae Culicinae Aedini Aedes Stegomyia NUCLEOTIDE SEQUENCE Black eye Salivary gland Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Belongs to the glycosyl hydrolase 22 family. Lacks conserved residue(s) required for the propagation of feature annotation. Antimicrobial Bacteriolytic enzyme Disulfide bond Glycosidase Hydrolase Signal MKQIAIIVTIAIACGLFGFGETKTFSECELAKLLHRTYNFDKNKVNNFVCLAQAESSLTTSKTHKNSNGSTDYGLFQINNKYWCSSAGFASGNDCKVSCADLMTNDITKAVNCANKVFARHGYNAWYGWKSKCSKGVKDLSYCM Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License