Q8T9B6 A1Z712 MESD_DROME LDLR chaperone boca boca CG30498 Drosophila melanogaster Fruit fly Eukaryota Metazoa Ecdysozoa Arthropoda Altocrustacea Allotriocarida Hexapoda Insecta Pterygota Neoptera Eumetabola Endopterygota Aparaglossata Panorpida Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] Berkeley GENOME REANNOTATION Berkeley NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Berkeley Embryo FUNCTION INTERACTION WITH ARROW AND YOLKLESS SUBCELLULAR LOCATION MUTAGENESIS OF TRP-49 Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wg pathway, since some LDLRs are coreceptors for the canonical Wnt pathway. Monomer (By similarity). Interacts with Arrow and Yolkless. Q8T9B6 Q8T9B6 boca false 3 Endoplasmic reticulum The LDLR maturation activity resides in the N- and C-terminal unstructured regions. Belongs to the MESD family. 3D-structure Chaperone Endoplasmic reticulum Reference proteome Signal Wnt signaling pathway W R L V MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKKDEL Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License