Q8G3T9 TYSY_BIFLO Thymidylate synthase TS TSase 2.1.1.45 thyA BL1665 Bifidobacterium longum (strain NCC 2705) Bacteria Bacillati Actinomycetota Actinomycetes Bifidobacteriales Bifidobacteriaceae Bifidobacterium NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] NCC 2705 Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis. dUMP + (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate = 7,8-dihydrofolate + dTMP Pyrimidine metabolism; dTTP biosynthesis. Homodimer. Cytoplasm Belongs to the thymidylate synthase family. Bacterial-type ThyA subfamily. Cytoplasm Methyltransferase Nucleotide biosynthesis Reference proteome Transferase dUMP ligand shared between dimeric partners dUMP ligand shared between dimeric partners dUMP ligand shared between dimeric partners (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate dUMP ligand shared between dimeric partners dUMP ligand shared between dimeric partners (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate MPYEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFDLSKYFPLLTTKTVFFKGLAYELLWFLKGSSNINWLLEHNVHIWDEWADENGDLGPVYGVQWRSWPAPTPEDPNRTIDQISNVLDLIKHHPDSRRMIVSAWNPAEVEKMALPPCHALFQFYVADDKLSCQLYQRSCDMFLGVPFNIASYSLLTMMMAQQAGLKPGEFVWTGGDCHVYDNHVDQFLEQLGRKPYPYPTIEIRKADSLFDYQYEDFKVVGYQHHPTIKAPVAV Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License