Q88QT9 GLPE_PSEPK Thiosulfate sulfurtransferase GlpE 2.8.1.1 glpE PP_0398 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) Bacteria Pseudomonadati Pseudomonadota Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440 Transferase that catalyzes the transfer of sulfur from thiosulfate to thiophilic acceptors such as cyanide or dithiols. May function in a CysM-independent thiosulfate assimilation pathway by catalyzing the conversion of thiosulfate to sulfite, which can then be used for L-cysteine biosynthesis. thiosulfate + hydrogen cyanide = thiocyanate + sulfite + 2 H(+) thiosulfate + [thioredoxin]-dithiol = [thioredoxin]-disulfide + hydrogen sulfide + sulfite + 2 H(+) Cytoplasm Belongs to the GlpE family. Cytoplasm Reference proteome Transferase MSEFKRIPPEQALELRKKEGAVVVDIRDPQAFAAGHITGARHLDNHSVADFIRNADLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPAETAQGNAE Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License