Q65QT9 PDXH_MANSM Pyridoxine/pyridoxamine 5'-phosphate oxidase 1.4.3.5 PNP/PMP oxidase PNPOx Pyridoxal 5'-phosphate synthase pdxH MS2064 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E) Bacteria Pseudomonadati Pseudomonadota Gammaproteobacteria Pasteurellales Pasteurellaceae Basfia NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] KCTC 0769BP / MBEL55E Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP). pyridoxamine 5'-phosphate + O2 + H2O = pyridoxal 5'-phosphate + H2O2 + NH4(+) pyridoxine 5'-phosphate + O2 = pyridoxal 5'-phosphate + H2O2 FMN Binds 1 FMN per subunit. Cofactor metabolism; pyridoxal 5'-phosphate salvage; pyridoxal 5'-phosphate from pyridoxamine 5'-phosphate: step 1/1. Cofactor metabolism; pyridoxal 5'-phosphate salvage; pyridoxal 5'-phosphate from pyridoxine 5'-phosphate: step 1/1. Homodimer. Belongs to the pyridoxamine 5'-phosphate oxidase family. Flavoprotein FMN Oxidoreductase Pyridoxine biosynthesis Reference proteome substrate FMN substrate FMN FMN FMN substrate substrate substrate FMN FMN substrate FMN MIDLHNIRNEYSQQALSEKQCDDDPLKQLEKWLNEAIQAKVNEPTAMNVATVGENGKPSSRVVLLKEVNERGLVFFTNYHSHKGRDLAVNPFAAVNLFWAELQRQVRVEGRVERISPQASDEYFASRPYTSRIGAWASEQSAVISGKNSLLTKAALIAAKHPLQVPRPPHWGGYIVIPELIEFWQGRPSRLHDRIRYRLEKGEWVRERLSP Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License