Q4A0T9 PANC_STAS1 Pantothenate synthetase PS 6.3.2.1 Pantoate--beta-alanine ligase Pantoate-activating enzyme panC SSP0155 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) Bacteria Bacillati Bacillota Bacilli Caryophanales Staphylococcaceae Staphylococcus NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41 Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate. (R)-pantoate + beta-alanine + ATP = (R)-pantothenate + AMP + diphosphate + H(+) Cofactor biosynthesis; (R)-pantothenate biosynthesis; (R)-pantothenate from (R)-pantoate and beta-alanine: step 1/1. Homodimer. Cytoplasm The reaction proceeds by a bi uni uni bi ping pong mechanism. Belongs to the pantothenate synthetase family. ATP-binding Cytoplasm Ligase Nucleotide-binding Pantothenate biosynthesis Reference proteome ATP (R)-pantoate beta-alanine ATP (R)-pantoate ATP ATP MTQLITTIEEMRSIIANLHNQRRSVGFIPTMGALHDGHLKMMSLSLNENDVTIISIFVNPLQFGPNEDLDSYPRDIVGDTAKAESVGVDYIFHPTVKEMYPELPTIELKAGRLASVLEGAERPGHFDGVVTVVNKLFNIVRPHKAYFGKKDAQQLAIVEKMVEDFNHPIEIKGVDIVREDDGLAKSSRNIYLTKNERIEAVHLYKSLCLAQSLYKNGERNSEKIIKATRDYLTEHTSGTIETVAIYSYPELVEQTQIKDSIFISLAVKFSKARLIDNIIIEG Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License