Q3SZT9 CYC2_BOVIN Cytochrome c 2 CYCT Bos taurus Bovine Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Crossbred X Angus Liver Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity). Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity). Mitochondrion intermembrane space Loosely associated with the inner membrane. Binds 1 heme c group covalently per subunit. Phosphorylation at Tyr-49 and Tyr-98 both reduce by half the turnover in the reaction with cytochrome c oxidase, down-regulating mitochondrial respiration. Belongs to the cytochrome c family. Life shuttle - Issue 76 of November 2006 Apoptosis Electron transport Heme Iron Metal-binding Mitochondrion Phosphoprotein Reference proteome Respiratory chain Transport heme c heme c heme c Fe heme c Fe MADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIWGEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License