Q1R7T9 CYSD_ECOUT Sulfate adenylyltransferase subunit 2 2.7.7.4 ATP-sulfurylase small subunit Sulfate adenylate transferase SAT cysD UTI89_C3123 Escherichia coli (strain UTI89 / UPEC) Bacteria Pseudomonadati Pseudomonadota Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] UTI89 / UPEC With CysN forms the ATP sulfurylase (ATPS) that catalyzes the adenylation of sulfate producing adenosine 5'-phosphosulfate (APS) and diphosphate, the first enzymatic step in sulfur assimilation pathway. APS synthesis involves the formation of a high-energy phosphoric-sulfuric acid anhydride bond driven by GTP hydrolysis by CysN coupled to ATP hydrolysis by CysD. sulfate + ATP + H(+) = adenosine 5'-phosphosulfate + diphosphate Sulfur metabolism; hydrogen sulfide biosynthesis; sulfite from sulfate: step 1/3. Heterodimer composed of CysD, the smaller subunit, and CysN. Belongs to the PAPS reductase family. CysD subfamily. ATP-binding Nucleotide-binding Nucleotidyltransferase Transferase MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRINLQSGEVIKKRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQGYF Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License