B8H6T9 RISB_PSECP 6,7-dimethyl-8-ribityllumazine synthase DMRL synthase LS Lumazine synthase 2.5.1.78 ribH Achl_1673 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6) Arthrobacter chlorophenolicus Bacteria Bacillati Actinomycetota Actinomycetes Micrococcales Micrococcaceae Pseudarthrobacter NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6 Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin. (2S)-2-hydroxy-3-oxobutyl phosphate + 5-amino-6-(D-ribitylamino)uracil = 6,7-dimethyl-8-(1-D-ribityl)lumazine + phosphate + 2 H2O + H(+) Cofactor biosynthesis; riboflavin biosynthesis; riboflavin from 2-hydroxy-3-oxobutyl phosphate and 5-amino-6-(D-ribitylamino)uracil: step 1/2. Belongs to the DMRL synthase family. Reference proteome Riboflavin biosynthesis Transferase 5-amino-6-(D-ribitylamino)uracil 5-amino-6-(D-ribitylamino)uracil 5-amino-6-(D-ribitylamino)uracil (2S)-2-hydroxy-3-oxobutyl phosphate 5-amino-6-(D-ribitylamino)uracil (2S)-2-hydroxy-3-oxobutyl phosphate MSGHGAPDIDLTTLNPAETSQLRLAIVAASWHTQIMDGLLDGALRAAKDAGINEPTVIRVPGSFELPVAAARLAPHFDAVVALGVVIRGGTPHFEYVCQAATSGLTDVSVRTGVPVGFGVLTCDTEQQGLDRAGLPGSKEDKGHEAVTAALATAVVLKQYS Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License